Fast UK mainland shipping 99%+ purity HPLC third party tested Rated excellent by researchers
Sale!
,

LL37 5mg

Original price was: £24.99.Current price is: £16.99.

Availability: 93 in stock

SKU: LL375 Categories: ,

Buy LL37 5mg UK – 99%+ Purity | HPLC 3rd Party Tested |
Premium Research Peptide | Fast UK Shipping

Product Name: LL37
SKU: LL375
CAS Number: 154947-66-7
Molecular Formula: C₂₀₅H₃₄₀N₆₀O₅₃
Format: Lyophilised powder in a sterile glass vial
Purity: ≥99% (HPLC verified on select batches)
Availability: UK stock – ships within 1-2 business days

The LL37 5mg UK is a high-purity, research-grade 37-amino acid cathelicidin antimicrobial peptide supplied as a lyophilised powder for laboratory applications only.

LL37 ensures consistent quality for precise experimental outcomes.

Key Specifications – LL37 5mg UK

  • Molecular Weight: 4493.3 g/mol
  • Sequence: [LL-37, 37 aa]
  • Synonyms: LL-37, Human Cathelicidin, CAMP (118-154), Ropocamptide
  • Appearance: White to off-white lyophilised solid
  • Solubility: Highly soluble in sterile water or bacteriostatic water

HPLC analysis is always included and can be found in our lab analysis docs on the site.

Each batch is produced in an ISO-certified facility with direct oversight, including High-Performance Liquid Chromatography (HPLC) on selected batches to confirm purity and identity. Certificates of Analysis (HPLC) are available on request.

For Research Use Only – This product is strictly for licensed laboratory research. It is not for human or veterinary use, nor for diagnostic or therapeutic application.

Storage & Reconstitution Guidelines for LL37 5mg UK

  • Lyophilised storage: Store at -20 °C in a dry, dark, desiccated environment.
  • Reconstituted storage: 2–8 °C for up to 30 days. For longer-term, aliquot and freeze at -20 °C. Avoid repeated freeze-thaw cycles.
  • Recommended solvent: Sterile bacteriostatic water (0.9% benzyl alcohol) or appropriate buffer.

Why Researchers Choose to Buy LL37 5mg UK from Us

  • UK-based stock for rapid 1-2 business day dispatch
  • Discreet, plain packaging with no identifiable markings
  • Transparent batch testing with HPLC provided

Frequently Asked Questions – LL37 5mg UK

Where can I buy LL37 in the UK?
We stock LL37 5mg ready for immediate dispatch—secure and compliant for research.

Is LL37 legal to buy in the UK?
Yes, for legitimate research purposes by qualified professionals or institutions.

How do I reconstitute LL37?
Gently add bacteriostatic water, swirl (do not shake) until dissolved, then store refrigerated.

What testing do you perform on LL37?
HPLC analysis on select batches to ensure purity and consistency.

Add LL37 5mg UK to your lab supplies today.

Research-Grade Peptides – UK Stock – Laboratory Standards

For Research Use Only. Not for Human or Veterinary Use. Intended for use by qualified researchers and laboratory professionals.

Typically ships within 1-2 business day dispatch.

Reviews

There are no reviews yet.

Be the first to review “LL37 5mg”

Your email address will not be published. Required fields are marked *

Scroll to Top